Product successfully added to your shopping cart
Quantity
Total
There are 85 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 32 204,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 32 204,28 €
Data sheet of PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00009468-D01P |
| Product name: | PCYT1B purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PCYT1B protein. |
| Gene id: | 9468 |
| Gene name: | PCYT1B |
| Gene alias: | CCT-beta|CTB |
| Gene description: | phosphate cytidylyltransferase 1, choline, beta |
| Genbank accession: | NM_004845.3 |
| Immunogen: | PCYT1B (NP_004836.2, 1 a.a. ~ 369 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK |
| Protein accession: | NP_004836.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PCYT1B expression in transfected 293T cell line (H00009468-T02) by PCYT1B MaxPab polyclonal antibody. Lane 1: PCYT1B transfected lysate(41.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |