Cart 1 Product Products 96,67 € (empty)
No products
To be determined Shipping
96,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 96,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 96,67 €
Data sheet of FHL5 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about FHL5 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00009457-D01P |
| Product name: | FHL5 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human FHL5 protein. |
| Gene id: | 9457 |
| Gene name: | FHL5 |
| Gene alias: | ACT|FLJ33049|KIAA0776|RP3-393D12.2|dJ393D12.2 |
| Gene description: | four and a half LIM domains 5 |
| Genbank accession: | BC021723.2 |
| Immunogen: | FHL5 (AAH21723.1, 1 a.a. ~ 284 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI |
| Protein accession: | AAH21723.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FHL5 expression in transfected 293T cell line (H00009457-T02) by FHL5 MaxPab polyclonal antibody. Lane 1: FHL5 transfected lysate(32.80 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |