H00009457-D01_100uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr,IP |
Brand: | Abnova |
Reference: | H00009457-D01 |
Product name: | FHL5 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human FHL5 protein. |
Gene id: | 9457 |
Gene name: | FHL5 |
Gene alias: | ACT|FLJ33049|KIAA0776|RP3-393D12.2|dJ393D12.2 |
Gene description: | four and a half LIM domains 5 |
Genbank accession: | BC021723.2 |
Immunogen: | FHL5 (AAH21723.1, 1 a.a. ~ 284 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI |
Protein accession: | AAH21723.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoprecipitation of FHL5 transfected lysate using anti-FHL5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FHL5 MaxPab mouse polyclonal antibody (B01) (H00009457-B01). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |