ITM2B purified MaxPab mouse polyclonal antibody (B01P) View larger

ITM2B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ITM2B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ITM2B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009445-B01P
Product name: ITM2B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ITM2B protein.
Gene id: 9445
Gene name: ITM2B
Gene alias: ABRI|BRI|BRI2|BRICD2B|E25B|E3-16|FBD
Gene description: integral membrane protein 2B
Genbank accession: BC016148.1
Immunogen: ITM2B (AAH16148.1, 1 a.a. ~ 266 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
Protein accession: AAH16148.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009445-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ITM2B expression in transfected 293T cell line (H00009445-T01) by ITM2B MaxPab polyclonal antibody.

Lane 1: ITM2B transfected lysate(29.26 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ITM2B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart