Brand: | Abnova |
Reference: | H00009439-M01 |
Product name: | CRSP3 monoclonal antibody (M01), clone 4H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CRSP3. |
Clone: | 4H6 |
Isotype: | IgG2a Kappa |
Gene id: | 9439 |
Gene name: | MED23 |
Gene alias: | CRSP130|CRSP133|CRSP3|DKFZp434H0117|DRIP130|SUR2 |
Gene description: | mediator complex subunit 23 |
Genbank accession: | NM_004830 |
Immunogen: | CRSP3 (NP_004821, 531 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL |
Protein accession: | NP_004821 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MED23 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |