Brand: | Abnova |
Reference: | H00009402-M01 |
Product name: | GRAP2 monoclonal antibody (M01), clone 1G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GRAP2. |
Clone: | 1G12 |
Isotype: | IgG2a Kappa |
Gene id: | 9402 |
Gene name: | GRAP2 |
Gene alias: | GADS|GRAP-2|GRB2L|GRBLG|GRID|GRPL|GrbX|Grf40|Mona|P38 |
Gene description: | GRB2-related adaptor protein 2 |
Genbank accession: | BC025692 |
Immunogen: | GRAP2 (AAH25692, 226 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN |
Protein accession: | AAH25692 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to GRAP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |