GRAP2 MaxPab mouse polyclonal antibody (B01) View larger

GRAP2 MaxPab mouse polyclonal antibody (B01)

H00009402-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRAP2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GRAP2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00009402-B01
Product name: GRAP2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human GRAP2 protein.
Gene id: 9402
Gene name: GRAP2
Gene alias: GADS|GRAP-2|GRB2L|GRBLG|GRID|GRPL|GrbX|Grf40|Mona|P38
Gene description: GRB2-related adaptor protein 2
Genbank accession: NM_004810
Immunogen: GRAP2 (NP_004801, 1 a.a. ~ 330 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Protein accession: NP_004801
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009402-B01-13-15-1.jpg
Application image note: Western Blot analysis of GRAP2 expression in transfected 293T cell line (H00009402-T02) by GRAP2 MaxPab polyclonal antibody.

Lane 1: GRAP2 transfected lysate(36.3 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GRAP2 MaxPab mouse polyclonal antibody (B01) now

Add to cart