LIPG polyclonal antibody (A01) View larger

LIPG polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LIPG polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about LIPG polyclonal antibody (A01)

Brand: Abnova
Reference: H00009388-A01
Product name: LIPG polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant LIPG.
Gene id: 9388
Gene name: LIPG
Gene alias: EDL|EL|PRO719
Gene description: lipase, endothelial
Genbank accession: NM_006033
Immunogen: LIPG (NP_006024, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
Protein accession: NP_006024
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009388-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009388-A01-1-4-1.jpg
Application image note: LIPG polyclonal antibody (A01), Lot # 070129JCSb Western Blot analysis of LIPG expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LIPG polyclonal antibody (A01) now

Add to cart