TAAR2 (Human) Recombinant Protein View larger

TAAR2 (Human) Recombinant Protein

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAAR2 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP

More info about TAAR2 (Human) Recombinant Protein

Brand: Abnova
Reference: H00009287-G01
Product name: TAAR2 (Human) Recombinant Protein
Product description: Human TAAR2 full-length ORF (NP_055441.2) recombinant protein without tag.
Gene id: 9287
Gene name: TAAR2
Gene alias: GPR58
Gene description: trace amine associated receptor 2
Genbank accession: NM_014626.2
Immunogen sequence/protein sequence: MYSFMAGSIFITIFGNLAMIISISYFKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKIYYSFDLMLSITSIFHLCSVAIDRFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAINNLRENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLFDALTWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKESE
Protein accession: NP_055441.2
Form: Liquid
Preparation method: in vitro wheat germ expression system with proprietary liposome technology
Recommend dilutions: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Tag: None
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP
Shipping condition: Dry Ice

Reviews

Buy TAAR2 (Human) Recombinant Protein now

Add to cart