Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009275-M01 |
Product name: | BCL7B monoclonal antibody (M01), clone 6D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BCL7B. |
Clone: | 6D2 |
Isotype: | IgG1 Kappa |
Gene id: | 9275 |
Gene name: | BCL7B |
Gene alias: | - |
Gene description: | B-cell CLL/lymphoma 7B |
Genbank accession: | NM_001707 |
Immunogen: | BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
Protein accession: | NP_001698 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2. Lane 1: BCL7B transfected lysate(22 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | BCL7B, a predictor of poor prognosis of pancreatic cancers, promotes cell motility and invasion by influencing CREB signaling.Taniuchi K, Furihata M, Naganuma S, Dabanaka K, Hanazaki K, Saibara T. Am J Cancer Res. 2018 Mar 1;8(3):387-404. |