BCL7B monoclonal antibody (M01), clone 6D2 View larger

BCL7B monoclonal antibody (M01), clone 6D2

H00009275-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCL7B monoclonal antibody (M01), clone 6D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about BCL7B monoclonal antibody (M01), clone 6D2

Brand: Abnova
Reference: H00009275-M01
Product name: BCL7B monoclonal antibody (M01), clone 6D2
Product description: Mouse monoclonal antibody raised against a partial recombinant BCL7B.
Clone: 6D2
Isotype: IgG1 Kappa
Gene id: 9275
Gene name: BCL7B
Gene alias: -
Gene description: B-cell CLL/lymphoma 7B
Genbank accession: NM_001707
Immunogen: BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Protein accession: NP_001698
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009275-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009275-M01-13-15-1.jpg
Application image note: Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2.

Lane 1: BCL7B transfected lysate(22 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: BCL7B, a predictor of poor prognosis of pancreatic cancers, promotes cell motility and invasion by influencing CREB signaling.Taniuchi K, Furihata M, Naganuma S, Dabanaka K, Hanazaki K, Saibara T.
Am J Cancer Res. 2018 Mar 1;8(3):387-404.

Reviews

Buy BCL7B monoclonal antibody (M01), clone 6D2 now

Add to cart