PSCD3 MaxPab mouse polyclonal antibody (B01) View larger

PSCD3 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSCD3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PSCD3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00009265-B01
Product name: PSCD3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PSCD3 protein.
Gene id: 9265
Gene name: CYTH3
Gene alias: ARNO3|GRP1|PSCD3
Gene description: cytohesin 3
Genbank accession: NM_004227.3
Immunogen: PSCD3 (NP_004218.1, 1 a.a. ~ 399 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Protein accession: NP_004218.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009265-B01-13-15-1.jpg
Application image note: Western Blot analysis of CYTH3 expression in transfected 293T cell line (H00009265-T01) by CYTH3 MaxPab polyclonal antibody.

Lane 1: PSCD3 transfected lysate(43.89 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSCD3 MaxPab mouse polyclonal antibody (B01) now

Add to cart