UBE2L6 MaxPab rabbit polyclonal antibody (D01) View larger

UBE2L6 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2L6 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about UBE2L6 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00009246-D01
Product name: UBE2L6 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human UBE2L6 protein.
Gene id: 9246
Gene name: UBE2L6
Gene alias: MGC40331|RIG-B|UBCH8
Gene description: ubiquitin-conjugating enzyme E2L 6
Genbank accession: NM_004223.3
Immunogen: UBE2L6 (NP_004214.1, 1 a.a. ~ 153 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Protein accession: NP_004214.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00009246-D01-31-15-1.jpg
Application image note: Immunoprecipitation of UBE2L6 transfected lysate using anti-UBE2L6 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UBE2L6 MaxPab mouse polyclonal antibody (B01) (H00009246-B01).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy UBE2L6 MaxPab rabbit polyclonal antibody (D01) now

Add to cart