Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009242-M05 |
Product name: | MSC monoclonal antibody (M05), clone 4D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSC. |
Clone: | 4D7 |
Isotype: | IgG2b Kappa |
Gene id: | 9242 |
Gene name: | MSC |
Gene alias: | ABF-1|ABF1|MYOR|bHLHa22 |
Gene description: | musculin (activated B-cell factor-1) |
Genbank accession: | NM_005098 |
Immunogen: | MSC (NP_005089.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGS |
Protein accession: | NP_005089.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MSC expression in transfected 293T cell line by MSC monoclonal antibody (M05), clone 4D7. Lane 1: MSC transfected lysate(22.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |