Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009241-M11 |
Product name: | NOG monoclonal antibody (M11), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NOG. |
Clone: | 2C10 |
Isotype: | IgG2b Kappa |
Gene id: | 9241 |
Gene name: | NOG |
Gene alias: | SYM1|SYNS1 |
Gene description: | noggin |
Genbank accession: | NM_005450 |
Immunogen: | NOG (NP_005441, 27 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL |
Protein accession: | NP_005441 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NOG expression in transfected 293T cell line by NOG monoclonal antibody (M11), clone 2C10. Lane 1: NOG transfected lysate(25.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |