NOG monoclonal antibody (M11), clone 2C10 View larger

NOG monoclonal antibody (M11), clone 2C10

H00009241-M11_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOG monoclonal antibody (M11), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NOG monoclonal antibody (M11), clone 2C10

Brand: Abnova
Reference: H00009241-M11
Product name: NOG monoclonal antibody (M11), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant NOG.
Clone: 2C10
Isotype: IgG2b Kappa
Gene id: 9241
Gene name: NOG
Gene alias: SYM1|SYNS1
Gene description: noggin
Genbank accession: NM_005450
Immunogen: NOG (NP_005441, 27 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL
Protein accession: NP_005441
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009241-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.09 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009241-M11-13-15-1.jpg
Application image note: Western Blot analysis of NOG expression in transfected 293T cell line by NOG monoclonal antibody (M11), clone 2C10.

Lane 1: NOG transfected lysate(25.8 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NOG monoclonal antibody (M11), clone 2C10 now

Add to cart