PTTG1 monoclonal antibody (M35), clone 2C3 View larger

PTTG1 monoclonal antibody (M35), clone 2C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTTG1 monoclonal antibody (M35), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PTTG1 monoclonal antibody (M35), clone 2C3

Brand: Abnova
Reference: H00009232-M35
Product name: PTTG1 monoclonal antibody (M35), clone 2C3
Product description: Mouse monoclonal antibody raised against a partial recombinant PTTG1.
Clone: 2C3
Isotype: IgG2b Kappa
Gene id: 9232
Gene name: PTTG1
Gene alias: EAP1|HPTTG|MGC126883|MGC138276|PTTG|TUTR1
Gene description: pituitary tumor-transforming 1
Genbank accession: NM_004219
Immunogen: PTTG1 (NP_004210, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA
Protein accession: NP_004210
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009232-M35-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009232-M35-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PTTG1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTTG1 monoclonal antibody (M35), clone 2C3 now

Add to cart