DLGAP1 monoclonal antibody (M02), clone 2A6 View larger

DLGAP1 monoclonal antibody (M02), clone 2A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLGAP1 monoclonal antibody (M02), clone 2A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DLGAP1 monoclonal antibody (M02), clone 2A6

Brand: Abnova
Reference: H00009229-M02
Product name: DLGAP1 monoclonal antibody (M02), clone 2A6
Product description: Mouse monoclonal antibody raised against a partial recombinant DLGAP1.
Clone: 2A6
Isotype: IgG2a Kappa
Gene id: 9229
Gene name: DLGAP1
Gene alias: DAP-1|DAP-1-ALPHA|DAP-1-BETA|GKAP|MGC88156|SAPAP1|hGKAP
Gene description: discs, large (Drosophila) homolog-associated protein 1
Genbank accession: NM_004746
Immunogen: DLGAP1 (NP_004737.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIP
Protein accession: NP_004737.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009229-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009229-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged DLGAP1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DLGAP1 monoclonal antibody (M02), clone 2A6 now

Add to cart