Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LRAT monoclonal antibody (M05), clone 4E12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about LRAT monoclonal antibody (M05), clone 4E12
| Brand: | Abnova |
| Reference: | H00009227-M05 |
| Product name: | LRAT monoclonal antibody (M05), clone 4E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LRAT. |
| Clone: | 4E12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9227 |
| Gene name: | LRAT |
| Gene alias: | MGC33103 |
| Gene description: | lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase) |
| Genbank accession: | NM_004744 |
| Immunogen: | LRAT (NP_004735.2, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQ |
| Protein accession: | NP_004735.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged LRAT is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |