VAPA purified MaxPab mouse polyclonal antibody (B01P) View larger

VAPA purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VAPA purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about VAPA purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009218-B01P
Product name: VAPA purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human VAPA protein.
Gene id: 9218
Gene name: VAPA
Gene alias: MGC3745|VAP-33|VAP-A|VAP33|hVAP-33
Gene description: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Genbank accession: ENST00000349843
Immunogen: VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Protein accession: ENSP00000217602
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009218-B01P-13-15-1.jpg
Application image note: Western Blot analysis of VAPA expression in transfected 293T cell line (H00009218-T01) by VAPA MaxPab polyclonal antibody.

Lane 1: VAPA transfected lysate(26.62 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VAPA purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart