Brand: | Abnova |
Reference: | H00009217-M10 |
Product name: | VAPB monoclonal antibody (M10), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VAPB. |
Clone: | 1A2 |
Isotype: | IgG2b Kappa |
Gene id: | 9217 |
Gene name: | VAPB |
Gene alias: | ALS8|VAMP-B|VAMP-C|VAP-B|VAP-C |
Gene description: | VAMP (vesicle-associated membrane protein)-associated protein B and C |
Genbank accession: | NM_004738 |
Immunogen: | VAPB (NP_004729.1, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTR |
Protein accession: | NP_004729.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged VAPB is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |