DCAMKL1 monoclonal antibody (M03), clone 6H4 View larger

DCAMKL1 monoclonal antibody (M03), clone 6H4

H00009201-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCAMKL1 monoclonal antibody (M03), clone 6H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about DCAMKL1 monoclonal antibody (M03), clone 6H4

Brand: Abnova
Reference: H00009201-M03
Product name: DCAMKL1 monoclonal antibody (M03), clone 6H4
Product description: Mouse monoclonal antibody raised against a partial recombinant DCAMKL1.
Clone: 6H4
Isotype: IgG1 Kappa
Gene id: 9201
Gene name: DCLK1
Gene alias: DCAMKL1|DCDC3A|DCLK|KIAA0369
Gene description: doublecortin-like kinase 1
Genbank accession: NM_004734
Immunogen: DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
Protein accession: NP_004725
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009201-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009201-M03-4-8-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DCAMKL1 monoclonal antibody (M03), clone 6H4 now

Add to cart