DCAMKL1 monoclonal antibody (M02A), clone 6F9 View larger

DCAMKL1 monoclonal antibody (M02A), clone 6F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCAMKL1 monoclonal antibody (M02A), clone 6F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about DCAMKL1 monoclonal antibody (M02A), clone 6F9

Brand: Abnova
Reference: H00009201-M02A
Product name: DCAMKL1 monoclonal antibody (M02A), clone 6F9
Product description: Mouse monoclonal antibody raised against a partial recombinant DCAMKL1.
Clone: 6F9
Isotype: IgG2b Kappa
Gene id: 9201
Gene name: DCLK1
Gene alias: DCAMKL1|DCDC3A|DCLK|KIAA0369
Gene description: doublecortin-like kinase 1
Genbank accession: NM_004734
Immunogen: DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
Protein accession: NP_004725
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009201-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009201-M02A-1-8-1.jpg
Application image note: DCAMKL1 monoclonal antibody (M02A), clone 6F9 Western Blot analysis of DCAMKL1 expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DCAMKL1 monoclonal antibody (M02A), clone 6F9 now

Add to cart