Brand: | Abnova |
Reference: | H00009201-M02 |
Product name: | DCAMKL1 monoclonal antibody (M02), clone 6F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DCAMKL1. |
Clone: | 6F9 |
Isotype: | IgG2b Kappa |
Gene id: | 9201 |
Gene name: | DCLK1 |
Gene alias: | DCAMKL1|DCDC3A|DCLK|KIAA0369 |
Gene description: | doublecortin-like kinase 1 |
Genbank accession: | NM_004734 |
Immunogen: | DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM |
Protein accession: | NP_004725 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |