SLC24A1 monoclonal antibody (M01), clone 1E12 View larger

SLC24A1 monoclonal antibody (M01), clone 1E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC24A1 monoclonal antibody (M01), clone 1E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC24A1 monoclonal antibody (M01), clone 1E12

Brand: Abnova
Reference: H00009187-M01
Product name: SLC24A1 monoclonal antibody (M01), clone 1E12
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC24A1.
Clone: 1E12
Isotype: IgG2a Kappa
Gene id: 9187
Gene name: SLC24A1
Gene alias: HsT17412|KIAA0702|NCKX|NCKX1|RODX
Gene description: solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Genbank accession: NM_004727
Immunogen: SLC24A1 (NP_004718, 162 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLTHEVEANV
Protein accession: NP_004718
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009187-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009187-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC24A1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC24A1 monoclonal antibody (M01), clone 1E12 now

Add to cart