OSMR monoclonal antibody (M03), clone 3E12 View larger

OSMR monoclonal antibody (M03), clone 3E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OSMR monoclonal antibody (M03), clone 3E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about OSMR monoclonal antibody (M03), clone 3E12

Brand: Abnova
Reference: H00009180-M03
Product name: OSMR monoclonal antibody (M03), clone 3E12
Product description: Mouse monoclonal antibody raised against a partial recombinant OSMR.
Clone: 3E12
Isotype: IgG2b Kappa
Gene id: 9180
Gene name: OSMR
Gene alias: MGC150626|MGC150627|MGC75127|OSMRB
Gene description: oncostatin M receptor
Genbank accession: NM_003999
Immunogen: OSMR (NP_003990.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP
Protein accession: NP_003990.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009180-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009180-M03-13-15-1.jpg
Application image note: Western Blot analysis of OSMR expression in transfected 293T cell line by OSMR monoclonal antibody (M03), clone 3E12.

Lane 1: OSMR transfected lysate(39.5 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy OSMR monoclonal antibody (M03), clone 3E12 now

Add to cart