Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009180-M03 |
Product name: | OSMR monoclonal antibody (M03), clone 3E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OSMR. |
Clone: | 3E12 |
Isotype: | IgG2b Kappa |
Gene id: | 9180 |
Gene name: | OSMR |
Gene alias: | MGC150626|MGC150627|MGC75127|OSMRB |
Gene description: | oncostatin M receptor |
Genbank accession: | NM_003999 |
Immunogen: | OSMR (NP_003990.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP |
Protein accession: | NP_003990.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of OSMR expression in transfected 293T cell line by OSMR monoclonal antibody (M03), clone 3E12. Lane 1: OSMR transfected lysate(39.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |