MAP3K13 monoclonal antibody (M04), clone 4H7 View larger

MAP3K13 monoclonal antibody (M04), clone 4H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K13 monoclonal antibody (M04), clone 4H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re,WB-Tr

More info about MAP3K13 monoclonal antibody (M04), clone 4H7

Brand: Abnova
Reference: H00009175-M04
Product name: MAP3K13 monoclonal antibody (M04), clone 4H7
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP3K13.
Clone: 4H7
Isotype: IgG2a Kappa
Gene id: 9175
Gene name: MAP3K13
Gene alias: LZK|MGC133196
Gene description: mitogen-activated protein kinase kinase kinase 13
Genbank accession: NM_004721
Immunogen: MAP3K13 (NP_004712.1, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK
Protein accession: NP_004712.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009175-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009175-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MAP3K13 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAP3K13 monoclonal antibody (M04), clone 4H7 now

Add to cart