Brand: | Abnova |
Reference: | H00009175-M04 |
Product name: | MAP3K13 monoclonal antibody (M04), clone 4H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K13. |
Clone: | 4H7 |
Isotype: | IgG2a Kappa |
Gene id: | 9175 |
Gene name: | MAP3K13 |
Gene alias: | LZK|MGC133196 |
Gene description: | mitogen-activated protein kinase kinase kinase 13 |
Genbank accession: | NM_004721 |
Immunogen: | MAP3K13 (NP_004712.1, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK |
Protein accession: | NP_004712.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MAP3K13 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |