TMSB10 monoclonal antibody (M02), clone 2E3 View larger

TMSB10 monoclonal antibody (M02), clone 2E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMSB10 monoclonal antibody (M02), clone 2E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TMSB10 monoclonal antibody (M02), clone 2E3

Brand: Abnova
Reference: H00009168-M02
Product name: TMSB10 monoclonal antibody (M02), clone 2E3
Product description: Mouse monoclonal antibody raised against a full-length recombinant TMSB10.
Clone: 2E3
Isotype: IgG2a Kappa
Gene id: 9168
Gene name: TMSB10
Gene alias: MIG12|TB10
Gene description: thymosin beta 10
Genbank accession: BC016025
Immunogen: TMSB10 (AAH16025, 1 a.a. ~ 44 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Protein accession: AAH16025
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009168-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (30.58 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009168-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TMSB10 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TMSB10 monoclonal antibody (M02), clone 2E3 now

Add to cart