EXO1 monoclonal antibody (M01), clone 1G12 View larger

EXO1 monoclonal antibody (M01), clone 1G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EXO1 monoclonal antibody (M01), clone 1G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EXO1 monoclonal antibody (M01), clone 1G12

Brand: Abnova
Reference: H00009156-M01
Product name: EXO1 monoclonal antibody (M01), clone 1G12
Product description: Mouse monoclonal antibody raised against a partial recombinant EXO1.
Clone: 1G12
Isotype: IgG1 Kappa
Gene id: 9156
Gene name: EXO1
Gene alias: HEX1|hExoI
Gene description: exonuclease 1
Genbank accession: BC007491
Immunogen: EXO1 (AAH07491, 747 a.a. ~ 846 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ
Protein accession: AAH07491
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009156-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009156-M01-1-4-1.jpg
Application image note: EXO1 monoclonal antibody (M01), clone 1G12 Western Blot analysis of EXO1 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EXO1 monoclonal antibody (M01), clone 1G12 now

Add to cart