Brand: | Abnova |
Reference: | H00009156-M01 |
Product name: | EXO1 monoclonal antibody (M01), clone 1G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EXO1. |
Clone: | 1G12 |
Isotype: | IgG1 Kappa |
Gene id: | 9156 |
Gene name: | EXO1 |
Gene alias: | HEX1|hExoI |
Gene description: | exonuclease 1 |
Genbank accession: | BC007491 |
Immunogen: | EXO1 (AAH07491, 747 a.a. ~ 846 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ |
Protein accession: | AAH07491 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EXO1 monoclonal antibody (M01), clone 1G12 Western Blot analysis of EXO1 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |