Brand: | Abnova |
Reference: | H00009153-M03 |
Product name: | SLC28A2 monoclonal antibody (M03), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC28A2. |
Clone: | 2D3 |
Isotype: | IgG2a Kappa |
Gene id: | 9153 |
Gene name: | SLC28A2 |
Gene alias: | CNT2|HCNT2|HsT17153|MGC138252|SPNT1 |
Gene description: | solute carrier family 28 (sodium-coupled nucleoside transporter), member 2 |
Genbank accession: | NM_004212 |
Immunogen: | SLC28A2 (NP_004203.1, 1 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK |
Protein accession: | NP_004203.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC28A2 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |