SLC28A2 monoclonal antibody (M03), clone 2D3 View larger

SLC28A2 monoclonal antibody (M03), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC28A2 monoclonal antibody (M03), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC28A2 monoclonal antibody (M03), clone 2D3

Brand: Abnova
Reference: H00009153-M03
Product name: SLC28A2 monoclonal antibody (M03), clone 2D3
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC28A2.
Clone: 2D3
Isotype: IgG2a Kappa
Gene id: 9153
Gene name: SLC28A2
Gene alias: CNT2|HCNT2|HsT17153|MGC138252|SPNT1
Gene description: solute carrier family 28 (sodium-coupled nucleoside transporter), member 2
Genbank accession: NM_004212
Immunogen: SLC28A2 (NP_004203.1, 1 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK
Protein accession: NP_004203.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009153-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009153-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC28A2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC28A2 monoclonal antibody (M03), clone 2D3 now

Add to cart