SLC6A5 monoclonal antibody (M01), clone 3B3 View larger

SLC6A5 monoclonal antibody (M01), clone 3B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC6A5 monoclonal antibody (M01), clone 3B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC6A5 monoclonal antibody (M01), clone 3B3

Brand: Abnova
Reference: H00009152-M01
Product name: SLC6A5 monoclonal antibody (M01), clone 3B3
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC6A5.
Clone: 3B3
Isotype: IgG1 Kappa
Gene id: 9152
Gene name: SLC6A5
Gene alias: GLYT2|NET1
Gene description: solute carrier family 6 (neurotransmitter transporter, glycine), member 5
Genbank accession: NM_004211
Immunogen: SLC6A5 (NP_004202, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR
Protein accession: NP_004202
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009152-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC6A5 monoclonal antibody (M01), clone 3B3 now

Add to cart