DYRK1B monoclonal antibody (M10), clone 2E8 View larger

DYRK1B monoclonal antibody (M10), clone 2E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DYRK1B monoclonal antibody (M10), clone 2E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about DYRK1B monoclonal antibody (M10), clone 2E8

Brand: Abnova
Reference: H00009149-M10
Product name: DYRK1B monoclonal antibody (M10), clone 2E8
Product description: Mouse monoclonal antibody raised against a partial recombinant DYRK1B.
Clone: 2E8
Isotype: IgG2a Kappa
Gene id: 9149
Gene name: DYRK1B
Gene alias: MIRK
Gene description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Genbank accession: BC025291
Immunogen: DYRK1B (AAH25291, 479 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
Protein accession: AAH25291
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009149-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009149-M10-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged DYRK1B is 0.03 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DYRK1B monoclonal antibody (M10), clone 2E8 now

Add to cart