Brand: | Abnova |
Reference: | H00009149-M10 |
Product name: | DYRK1B monoclonal antibody (M10), clone 2E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DYRK1B. |
Clone: | 2E8 |
Isotype: | IgG2a Kappa |
Gene id: | 9149 |
Gene name: | DYRK1B |
Gene alias: | MIRK |
Gene description: | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B |
Genbank accession: | BC025291 |
Immunogen: | DYRK1B (AAH25291, 479 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV |
Protein accession: | AAH25291 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DYRK1B is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |