HGS monoclonal antibody (M01), clone 6D11 View larger

HGS monoclonal antibody (M01), clone 6D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HGS monoclonal antibody (M01), clone 6D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about HGS monoclonal antibody (M01), clone 6D11

Brand: Abnova
Reference: H00009146-M01
Product name: HGS monoclonal antibody (M01), clone 6D11
Product description: Mouse monoclonal antibody raised against a partial recombinant HGS.
Clone: 6D11
Isotype: IgG1 Kappa
Gene id: 9146
Gene name: HGS
Gene alias: HRS|ZFYVE8
Gene description: hepatocyte growth factor-regulated tyrosine kinase substrate
Genbank accession: BC003565
Immunogen: HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Protein accession: AAH03565
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009146-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009146-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: The Class III Kinase Vps34 Promotes T Lymphocyte Survival through Regulating IL-7Rα Surface Expression.McLeod IX, Zhou X, Li QJ, Wang F, He YW.
J Immunol. 2011 Nov 15;187(10):5051-61. Epub 2011 Oct 21.

Reviews

Buy HGS monoclonal antibody (M01), clone 6D11 now

Add to cart