Brand: | Abnova |
Reference: | H00009144-M03 |
Product name: | SYNGR2 monoclonal antibody (M03), clone 1G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SYNGR2. |
Clone: | 1G7 |
Isotype: | IgG3 Kappa |
Gene id: | 9144 |
Gene name: | SYNGR2 |
Gene alias: | MGC102914 |
Gene description: | synaptogyrin 2 |
Genbank accession: | NM_004710 |
Immunogen: | SYNGR2 (NP_004701, 168 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY |
Protein accession: | NP_004701 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |