SYNGR2 monoclonal antibody (M01), clone 5C3 View larger

SYNGR2 monoclonal antibody (M01), clone 5C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYNGR2 monoclonal antibody (M01), clone 5C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SYNGR2 monoclonal antibody (M01), clone 5C3

Brand: Abnova
Reference: H00009144-M01
Product name: SYNGR2 monoclonal antibody (M01), clone 5C3
Product description: Mouse monoclonal antibody raised against a partial recombinant SYNGR2.
Clone: 5C3
Isotype: IgG3 Kappa
Gene id: 9144
Gene name: SYNGR2
Gene alias: MGC102914
Gene description: synaptogyrin 2
Genbank accession: NM_004710
Immunogen: SYNGR2 (NP_004701, 168 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
Protein accession: NP_004701
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009144-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009144-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SYNGR2 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SYNGR2 monoclonal antibody (M01), clone 5C3 now

Add to cart