ATG12 monoclonal antibody (M03), clone 1F9 View larger

ATG12 monoclonal antibody (M03), clone 1F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATG12 monoclonal antibody (M03), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ATG12 monoclonal antibody (M03), clone 1F9

Brand: Abnova
Reference: H00009140-M03
Product name: ATG12 monoclonal antibody (M03), clone 1F9
Product description: Mouse monoclonal antibody raised against a full-length recombinant ATG12.
Clone: 1F9
Isotype: IgG1 Kappa
Gene id: 9140
Gene name: ATG12
Gene alias: APG12|APG12L|FBR93|HAPG12
Gene description: ATG12 autophagy related 12 homolog (S. cerevisiae)
Genbank accession: BC012266
Immunogen: ATG12 (AAH12266, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Protein accession: AAH12266
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009140-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.14 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009140-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ATG12 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATG12 monoclonal antibody (M03), clone 1F9 now

Add to cart