CBFA2T2 monoclonal antibody (M15), clone 2C10 View larger

CBFA2T2 monoclonal antibody (M15), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CBFA2T2 monoclonal antibody (M15), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CBFA2T2 monoclonal antibody (M15), clone 2C10

Brand: Abnova
Reference: H00009139-M15
Product name: CBFA2T2 monoclonal antibody (M15), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant CBFA2T2.
Clone: 2C10
Isotype: IgG2b Kappa
Gene id: 9139
Gene name: CBFA2T2
Gene alias: DKFZp313F2116|EHT|MTGR1|ZMYND3
Gene description: core-binding factor, runt domain, alpha subunit 2; translocated to, 2
Genbank accession: NM_001032999
Immunogen: CBFA2T2 (NP_001028171.1, 201 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE
Protein accession: NP_001028171.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009139-M15-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009139-M15-13-15-1.jpg
Application image note: Western Blot analysis of CBFA2T2 expression in transfected 293T cell line by CBFA2T2 monoclonal antibody (M15), clone 2C10.

Lane 1: CBFA2T2 transfected lysate(63.9 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CBFA2T2 monoclonal antibody (M15), clone 2C10 now

Add to cart