CBFA2T2 monoclonal antibody (M07), clone 3G8 View larger

CBFA2T2 monoclonal antibody (M07), clone 3G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CBFA2T2 monoclonal antibody (M07), clone 3G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CBFA2T2 monoclonal antibody (M07), clone 3G8

Brand: Abnova
Reference: H00009139-M07
Product name: CBFA2T2 monoclonal antibody (M07), clone 3G8
Product description: Mouse monoclonal antibody raised against a partial recombinant CBFA2T2.
Clone: 3G8
Isotype: IgG2b Kappa
Gene id: 9139
Gene name: CBFA2T2
Gene alias: DKFZp313F2116|EHT|MTGR1|ZMYND3
Gene description: core-binding factor, runt domain, alpha subunit 2; translocated to, 2
Genbank accession: NM_001032999
Immunogen: CBFA2T2 (NP_001028171.1, 201 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE
Protein accession: NP_001028171.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009139-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CBFA2T2 monoclonal antibody (M07), clone 3G8 now

Add to cart