ARHGEF1 monoclonal antibody (M03), clone 4C4 View larger

ARHGEF1 monoclonal antibody (M03), clone 4C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGEF1 monoclonal antibody (M03), clone 4C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about ARHGEF1 monoclonal antibody (M03), clone 4C4

Brand: Abnova
Reference: H00009138-M03
Product name: ARHGEF1 monoclonal antibody (M03), clone 4C4
Product description: Mouse monoclonal antibody raised against a partial recombinant ARHGEF1.
Clone: 4C4
Isotype: IgG2a Kappa
Gene id: 9138
Gene name: ARHGEF1
Gene alias: GEF1|LBCL2|LSC|P115-RHOGEF|SUB1.5
Gene description: Rho guanine nucleotide exchange factor (GEF) 1
Genbank accession: BC034013
Immunogen: ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Protein accession: AAH34013.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009138-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009138-M03-1-9-1.jpg
Application image note: ARHGEF1 monoclonal antibody (M03), clone 4C4 Western Blot analysis of ARHGEF1 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Loss of lsc/p115-protein leads to neuronal hypoplasia in the esophagus and an achalasia-like phenotype in mice.Zizer E, Beilke S, Bauerle T, Schilling K, Mohnle U, Adler G, Fischer KD, Wagner M.
Gastroenterology. 2010 Jun 20. [Epub ahead of print]

Reviews

Buy ARHGEF1 monoclonal antibody (M03), clone 4C4 now

Add to cart