RABEP1 monoclonal antibody (M06), clone 3H6 View larger

RABEP1 monoclonal antibody (M06), clone 3H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RABEP1 monoclonal antibody (M06), clone 3H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RABEP1 monoclonal antibody (M06), clone 3H6

Brand: Abnova
Reference: H00009135-M06
Product name: RABEP1 monoclonal antibody (M06), clone 3H6
Product description: Mouse monoclonal antibody raised against a partial recombinant RABEP1.
Clone: 3H6
Isotype: IgG1 Kappa
Gene id: 9135
Gene name: RABEP1
Gene alias: RAB5EP|RABPT5
Gene description: rabaptin, RAB GTPase binding effector protein 1
Genbank accession: NM_004703
Immunogen: RABEP1 (NP_004694.2, 765 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET
Protein accession: NP_004694.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009135-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009135-M06-1-12-1.jpg
Application image note: RABEP1 monoclonal antibody (M06), clone 3H6. Western Blot analysis of RABEP1 expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RABEP1 monoclonal antibody (M06), clone 3H6 now

Add to cart