KCNQ4 monoclonal antibody (M01), clone 2H6 View larger

KCNQ4 monoclonal antibody (M01), clone 2H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNQ4 monoclonal antibody (M01), clone 2H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about KCNQ4 monoclonal antibody (M01), clone 2H6

Brand: Abnova
Reference: H00009132-M01
Product name: KCNQ4 monoclonal antibody (M01), clone 2H6
Product description: Mouse monoclonal antibody raised against a partial recombinant KCNQ4.
Clone: 2H6
Isotype: IgG3 Kappa
Gene id: 9132
Gene name: KCNQ4
Gene alias: DFNA2|KV7.4
Gene description: potassium voltage-gated channel, KQT-like subfamily, member 4
Genbank accession: NM_004700
Immunogen: KCNQ4 (NP_004691, 596 a.a. ~ 695 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Protein accession: NP_004691
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009132-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009132-M01-1-19-1.jpg
Application image note: KCNQ4 monoclonal antibody (M01), clone 2H6 Western Blot analysis of KCNQ4 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KCNQ4 monoclonal antibody (M01), clone 2H6 now

Add to cart