FAM50A monoclonal antibody (M02), clone 5F10 View larger

FAM50A monoclonal antibody (M02), clone 5F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM50A monoclonal antibody (M02), clone 5F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about FAM50A monoclonal antibody (M02), clone 5F10

Brand: Abnova
Reference: H00009130-M02
Product name: FAM50A monoclonal antibody (M02), clone 5F10
Product description: Mouse monoclonal antibody raised against a partial recombinant FAM50A.
Clone: 5F10
Isotype: IgG2a Kappa
Gene id: 9130
Gene name: FAM50A
Gene alias: 9F|DXS9928E|HXC-26|XAP5
Gene description: family with sequence similarity 50, member A
Genbank accession: NM_004699
Immunogen: FAM50A (NP_004690, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
Protein accession: NP_004690
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009130-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00009130-M02-1-25-1.jpg
Application image note: FAM50A monoclonal antibody (M02), clone 5F10 Western Blot analysis of FAM50A expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FAM50A monoclonal antibody (M02), clone 5F10 now

Add to cart