ATP6V0D1 monoclonal antibody (M19), clone 3B7 View larger

ATP6V0D1 monoclonal antibody (M19), clone 3B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP6V0D1 monoclonal antibody (M19), clone 3B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ATP6V0D1 monoclonal antibody (M19), clone 3B7

Brand: Abnova
Reference: H00009114-M19
Product name: ATP6V0D1 monoclonal antibody (M19), clone 3B7
Product description: Mouse monoclonal antibody raised against a full-length recombinant ATP6V0D1.
Clone: 3B7
Isotype: IgG2b Kappa
Gene id: 9114
Gene name: ATP6V0D1
Gene alias: ATP6D|ATP6DV|P39|VATX|VMA6|VPATPD
Gene description: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
Genbank accession: BC008861
Immunogen: ATP6V0D1 (AAH08861, 1 a.a. ~ 351 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSFFPEHYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Protein accession: AAH08861
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009114-M19-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (64.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009114-M19-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ATP6V0D1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP6V0D1 monoclonal antibody (M19), clone 3B7 now

Add to cart