ATP6V0D1 monoclonal antibody (M02), clone 3B8 View larger

ATP6V0D1 monoclonal antibody (M02), clone 3B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP6V0D1 monoclonal antibody (M02), clone 3B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ATP6V0D1 monoclonal antibody (M02), clone 3B8

Brand: Abnova
Reference: H00009114-M02
Product name: ATP6V0D1 monoclonal antibody (M02), clone 3B8
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP6V0D1.
Clone: 3B8
Isotype: IgG2a Kappa
Gene id: 9114
Gene name: ATP6V0D1
Gene alias: ATP6D|ATP6DV|P39|VATX|VMA6|VPATPD
Gene description: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
Genbank accession: NM_004691
Immunogen: ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN
Protein accession: NP_004682
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009114-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009114-M02-1-1-1.jpg
Application image note: ATP6V0D1 monoclonal antibody (M02), clone 3B8. Western Blot analysis of ATP6V0D1 expression in HeLa(Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP6V0D1 monoclonal antibody (M02), clone 3B8 now

Add to cart