Brand: | Abnova |
Reference: | H00009114-M01 |
Product name: | ATP6V0D1 monoclonal antibody (M01), clone 2G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V0D1. |
Clone: | 2G12 |
Isotype: | IgG1 Kappa |
Gene id: | 9114 |
Gene name: | ATP6V0D1 |
Gene alias: | ATP6D|ATP6DV|P39|VATX|VMA6|VPATPD |
Gene description: | ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 |
Genbank accession: | NM_004691 |
Immunogen: | ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN |
Protein accession: | NP_004682 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Proteomic analysis of endosomes from genetically modified p14/MP1 mouse embryonic fibroblasts.Stasyk T, Holzmann J, Stumberger S, Ebner HL, Hess MW, Bonn GK, Mechtler K, Huber LA. PROTEOMICS (2010) DOI: 10.1002/ pmic.201000258 |