Brand: | Abnova |
Reference: | H00009112-M09A |
Product name: | MTA1 monoclonal antibody (M09A), clone 3A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MTA1. |
Clone: | 3A3 |
Isotype: | IgG1 Kappa |
Gene id: | 9112 |
Gene name: | MTA1 |
Gene alias: | - |
Gene description: | metastasis associated 1 |
Genbank accession: | NM_004689 |
Immunogen: | MTA1 (NP_004680, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP |
Protein accession: | NP_004680 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |