NMI monoclonal antibody (M04), clone 9E8 View larger

NMI monoclonal antibody (M04), clone 9E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NMI monoclonal antibody (M04), clone 9E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about NMI monoclonal antibody (M04), clone 9E8

Brand: Abnova
Reference: H00009111-M04
Product name: NMI monoclonal antibody (M04), clone 9E8
Product description: Mouse monoclonal antibody raised against a partial recombinant NMI.
Clone: 9E8
Isotype: IgG2b Kappa
Gene id: 9111
Gene name: NMI
Gene alias: -
Gene description: N-myc (and STAT) interactor
Genbank accession: BC001268
Immunogen: NMI (AAH01268, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI
Protein accession: AAH01268
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009111-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009111-M04-1-1-1.jpg
Application image note: NMI monoclonal antibody (M04), clone 9E8 Western Blot analysis of NMI expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Nmi interacts with Hsp105β and enhances the Hsp105β-mediated Hsp70 expression.Saito Y, Yukawa A, Matozaki M, Mikami H, Yamagami T, Yamagishi N, Kuga T, Hatayama T, Nakayama Y
Exp Cell Res. 2014 Aug 1. pii: S0014-4827(14)00314-0. doi: 10.1016/j.yexcr.2014.07.023.

Reviews

Buy NMI monoclonal antibody (M04), clone 9E8 now

Add to cart