Brand: | Abnova |
Reference: | H00009111-M02 |
Product name: | NMI monoclonal antibody (M02), clone 10E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NMI. |
Clone: | 10E5 |
Isotype: | IgG2b Kappa |
Gene id: | 9111 |
Gene name: | NMI |
Gene alias: | - |
Gene description: | N-myc (and STAT) interactor |
Genbank accession: | BC001268 |
Immunogen: | NMI (AAH01268, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI |
Protein accession: | AAH01268 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NMI monoclonal antibody (M02), clone 10E5 Western Blot analysis of NMI expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |