RGN monoclonal antibody (M04), clone 4B9 View larger

RGN monoclonal antibody (M04), clone 4B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGN monoclonal antibody (M04), clone 4B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about RGN monoclonal antibody (M04), clone 4B9

Brand: Abnova
Reference: H00009104-M04
Product name: RGN monoclonal antibody (M04), clone 4B9
Product description: Mouse monoclonal antibody raised against a partial recombinant RGN.
Clone: 4B9
Isotype: IgG2a Kappa
Gene id: 9104
Gene name: RGN
Gene alias: RC|SMP30
Gene description: regucalcin (senescence marker protein-30)
Genbank accession: NM_004683
Immunogen: RGN (NP_004674.1, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Protein accession: NP_004674.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009104-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009104-M04-13-15-1.jpg
Application image note: Western Blot analysis of RGN expression in transfected 293T cell line by RGN monoclonal antibody (M04), clone 4B9.

Lane 1: RGN transfected lysate(33.3 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RGN monoclonal antibody (M04), clone 4B9 now

Add to cart