Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009104-M04 |
Product name: | RGN monoclonal antibody (M04), clone 4B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RGN. |
Clone: | 4B9 |
Isotype: | IgG2a Kappa |
Gene id: | 9104 |
Gene name: | RGN |
Gene alias: | RC|SMP30 |
Gene description: | regucalcin (senescence marker protein-30) |
Genbank accession: | NM_004683 |
Immunogen: | RGN (NP_004674.1, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG |
Protein accession: | NP_004674.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RGN expression in transfected 293T cell line by RGN monoclonal antibody (M04), clone 4B9. Lane 1: RGN transfected lysate(33.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |