USP10 monoclonal antibody (M01), clone 3B8 View larger

USP10 monoclonal antibody (M01), clone 3B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP10 monoclonal antibody (M01), clone 3B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about USP10 monoclonal antibody (M01), clone 3B8

Brand: Abnova
Reference: H00009100-M01
Product name: USP10 monoclonal antibody (M01), clone 3B8
Product description: Mouse monoclonal antibody raised against a partial recombinant USP10.
Clone: 3B8
Isotype: IgG2a Kappa
Gene id: 9100
Gene name: USP10
Gene alias: KIAA0190|MGC2621|UBPO
Gene description: ubiquitin specific peptidase 10
Genbank accession: NM_005153
Immunogen: USP10 (NP_005144, 699 a.a. ~ 797 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDL
Protein accession: NP_005144
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009100-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009100-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged USP10 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP10 monoclonal antibody (M01), clone 3B8 now

Add to cart