Brand: | Abnova |
Reference: | H00009096-M06 |
Product name: | TBX18 monoclonal antibody (M06), clone 4D3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TBX18. |
Clone: | 4D3 |
Isotype: | IgG2a Kappa |
Gene id: | 9096 |
Gene name: | TBX18 |
Gene alias: | - |
Gene description: | T-box 18 |
Genbank accession: | XM_496819 |
Immunogen: | TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF |
Protein accession: | XP_496819 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | TBX18 monoclonal antibody (M06), clone 4D3 Western Blot analysis of TBX18 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |