TBX18 monoclonal antibody (M05), clone 1A1 View larger

TBX18 monoclonal antibody (M05), clone 1A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBX18 monoclonal antibody (M05), clone 1A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TBX18 monoclonal antibody (M05), clone 1A1

Brand: Abnova
Reference: H00009096-M05
Product name: TBX18 monoclonal antibody (M05), clone 1A1
Product description: Mouse monoclonal antibody raised against a full length recombinant TBX18.
Clone: 1A1
Isotype: IgG2a Kappa
Gene id: 9096
Gene name: TBX18
Gene alias: -
Gene description: T-box 18
Genbank accession: XM_496819
Immunogen: TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Protein accession: XP_496819
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009096-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00009096-M05-1-25-1.jpg
Application image note: TBX18 monoclonal antibody (M05), clone 1A1 Western Blot analysis of TBX18 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TBX18 monoclonal antibody (M05), clone 1A1 now

Add to cart